PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_55519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 155aa    MW: 15926.2 Da    PI: 9.0684
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_55519.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB27.86.1e-091041542676
         NF-YB  26 kiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGf 76 
                    + kda     e +  fi ++++ a+d c+  kr+tin++d++ al ++ f
  MLOC_55519.1 104 IVNKDAMAAFAESARIFIHYLSATANDVCKDGKRQTINAEDVFKALDEIEF 154
                   47899999*************************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.0E-2269154IPR009072Histone-fold
SuperFamilySSF471138.56E-1874154IPR009072Histone-fold
PfamPF008083.3E-8105149IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MAGEAKEPQA DGSKPKVKKP KAAAAVAQDG DGAKVKAKKP KAGQEGDGAK AKKAAAAVAA  60
APVAAMTEAE VEELPKAIVR RLVKDKLARV ASGGEGAEGG AEVIVNKDAM AAFAESARIF  120
IHYLSATAND VCKDGKRQTI NAEDVFKALD EIEFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3710680.0AK371068.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2124A02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010238535.11e-49PREDICTED: DNA polymerase epsilon subunit 3-like
TrEMBLM0WXV81e-103M0WXV8_HORVD; Uncharacterized protein
STRINGMLOC_55519.11e-102(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104143744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27470.16e-25nuclear factor Y, subunit B11